Protein Info for DZA65_RS12930 in Dickeya dianthicola ME23

Annotation: YcjX family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 PF04317: DUF463" amino acids 26 to 470 (445 residues), 625.9 bits, see alignment E=2.2e-192

Best Hits

Swiss-Prot: 73% identical to YCJX_ECOLI: Uncharacterized protein YcjX (ycjX) from Escherichia coli (strain K12)

KEGG orthology group: K06918, (no description) (inferred from 99% identity to ddd:Dda3937_03119)

Predicted SEED Role

"Conserved protein YcjX with nucleoside triphosphate hydrolase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CCZ3 at UniProt or InterPro

Protein Sequence (471 amino acids)

>DZA65_RS12930 YcjX family protein (Dickeya dianthicola ME23)
MAYSLPFNRLQSEFNALVNRSADRHLRLAVTGLSRSGKTAFITSLVNQLLNAQHGARLPL
FSVARENRLLGARRIPQRDLGIPRFAYDEGMASLYGVPPAWPTPTRGVSEIRLALRYRSR
DSLMRHFRDTATLYLEIVDYPGEWLLDLPLLEQNYADWSRQMAAMLQGDRLGWAQPWLAL
CEGLDPLAPADENRLAAIAQAYTDYLLRCKQEGLHFIQPGRFVLPGDLAGAPVLQFFPWP
WPDDRLDAALAQAGDHTLIGMLRQRFEYYCQHVVREFYRQHFVRFDRQIVLVDCLQPLNH
GVQSFNDMRLALTQLMQSFHYGKRTLLRRLFSPCIDRLMFAASQSDHITADQHANLVSLL
QQLVQEAWRNAAFEGIEIDCAGIASVQATQSGVVSHQGQSLPALRGNRLADGEPVTVYPG
DVPSRLPDPSFWREQGFHFEPFRPLEMQTDAPLPHIRLDTVMEFLLGDKLR