Protein Info for DZA65_RS12820 in Dickeya dianthicola ME23

Annotation: PAS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 transmembrane" amino acids 169 to 188 (20 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 20 to 114 (95 residues), 38.7 bits, see alignment E=4.8e-14 PF00989: PAS" amino acids 21 to 104 (84 residues), 23.6 bits, see alignment E=1.3e-08 PF08448: PAS_4" amino acids 23 to 112 (90 residues), 27.2 bits, see alignment E=1.2e-09 PF13426: PAS_9" amino acids 23 to 107 (85 residues), 33.7 bits, see alignment E=1.2e-11 PF08447: PAS_3" amino acids 31 to 113 (83 residues), 61.5 bits, see alignment E=2.2e-20 PF00672: HAMP" amino acids 212 to 257 (46 residues), 27.4 bits, see alignment 1e-09 PF00015: MCPsignal" amino acids 338 to 482 (145 residues), 145.7 bits, see alignment E=3.8e-46

Best Hits

KEGG orthology group: K03776, aerotaxis receptor (inferred from 95% identity to ddd:Dda3937_03145)

Predicted SEED Role

"Aerotaxis sensor receptor protein" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XYJ6 at UniProt or InterPro

Protein Sequence (517 amino acids)

>DZA65_RS12820 PAS domain-containing protein (Dickeya dianthicola ME23)
MRKNYPVSQRQYPLDAKTKLMSVTTPDSHITYANADFINVSGYEPEELMNQPHNIIRHPD
MPPSAFADMWNTLKAGKIWTGVVKNRCKNGDHYWVRSSTTPLKRDGKLMGYMSVRTAATA
EEISQAEALYAQVNQGTLGNRAFHHGLLVYTGPLKWLSLFKAMPLRWRIRSYFGLLGGLP
LAVAFALLPKTALIWGLFPALMALACLFCELLVQQVARPVEQILEQAMRSAAGQANSLTP
LNRADEIGMLMRAVNQSGMNFRTFVDDVNSNLQELKIACSEIAQGNHILAECCEKTEESL
QQTAASVEQLTATIKSNADASQRASQYAQDVNQVVNVGEQAVSEVANTMQAITRASERIT
NIIGVLDNLAFQTNILAINAAVEAAHAGEQGKSFAVVASEVRSLAQRSAASAKDIAALID
NTLSSIRAGDQQVVHTNRSMNNILVKVQDVTHLMNDISLATQEQSQGLQQINDAVNRIDE
LTHQNTALASQSNSATGHLQQQIASIAQAVSVFGASK