Protein Info for DZA65_RS12760 in Dickeya dianthicola ME23

Annotation: two-component system response regulator RstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF00072: Response_reg" amino acids 4 to 112 (109 residues), 75.3 bits, see alignment E=4.2e-25 PF00486: Trans_reg_C" amino acids 162 to 237 (76 residues), 75.6 bits, see alignment E=2.6e-25

Best Hits

KEGG orthology group: K07661, two-component system, OmpR family, response regulator RstA (inferred from 94% identity to ddc:Dd586_1754)

Predicted SEED Role

"Transcriptional regulatory protein RstA" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CC95 at UniProt or InterPro

Protein Sequence (247 amino acids)

>DZA65_RS12760 two-component system response regulator RstA (Dickeya dianthicola ME23)
MYKVVFVEDDPEVGKLIAAYLGKHDIDVRIEPRGDNALAFIEAQQPDLVLLDIMLPGKDG
MTICRELRPRFTGPIVLLTSLDSDMNHILSLEMGADDYILKTTPPAVLLARLRLHFRQYA
TAPQPAAEKSAPGKTPVQVHKSLHFGLLCIDPVNRDVTLADENITLSTSDFDLLWLLSTH
AGQIMDREALLKALRGVSYDGMDRSIDVAISRLRKKLYDNALEPVRIKTIRNKGYLFAPN
AWETLAP