Protein Info for DZA65_RS12735 in Dickeya dianthicola ME23

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 112 to 135 (24 residues), see Phobius details amino acids 147 to 172 (26 residues), see Phobius details amino acids 184 to 201 (18 residues), see Phobius details amino acids 213 to 234 (22 residues), see Phobius details amino acids 260 to 284 (25 residues), see Phobius details amino acids 315 to 341 (27 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 24 to 114 (91 residues), 40.8 bits, see alignment E=2.2e-14 PF00528: BPD_transp_1" amino acids 126 to 346 (221 residues), 135.9 bits, see alignment E=1.4e-43

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 97% identity to ddd:Dda3937_00115)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2); putative hemin permease" (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DC74 at UniProt or InterPro

Protein Sequence (346 amino acids)

>DZA65_RS12735 ABC transporter permease (Dickeya dianthicola ME23)
MSPFYQQIWGTAARPGKVLGGFLSLSLTLLGLLFFTFLLTHLASTDQALPVAGEHASDAT
YSQVRQQLGLDQPVWLQFWHYLSALLQGDFGVSRTTAQPVLQDLLRTFPATFELATSAIV
IGFGGGITLALLSALKPGGVLDYLVRGVTLLGYSVPVFWIGLLSLLLFYAVLHWSAGPGR
FDDIYQYSAELPTGFVLLGGWNSNLAMFRNALAHLWLPASVLGFVSMASIARMLRTAILE
ECGKEYVTLARAMGASPLRILFFHILPNIQTVMVTVLMLSYASLLEGAILVETVFSWPGV
GRYLTTALFAADIPAVLGATLLIGVCFILLNALADALIFLLDPRTR