Protein Info for DZA65_RS12515 in Dickeya dianthicola ME23

Annotation: GAF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13185: GAF_2
  • amino acids 38 to 144 (107 residues), 39.5 bits, E=6.3e-14
• PF01590: GAF
  • amino acids 41 to 152 (112 residues), 39.7 bits, E=7.2e-14

Best Hits

Swiss-Prot: 61% identical to MSRC_ECOLI: Free methionine-R-sulfoxide reductase (msrC) from Escherichia coli (strain K12)

KEGG orthology group: K07170, GAF domain-containing protein (inferred from 95% identity to ddd:Dda3937_03781)

MetaCyc: 61% identical to free methionine-(R)-sulfoxide reductase (Escherichia coli K-12 substr. MG1655)
L-methionine (R)-S-oxide reductase. [EC: 1.8.4.14]

Predicted SEED Role

"Free methionine-(R)-sulfoxide reductase, contains GAF domain"

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.14

Sequence Analysis Tools

See A0A385XY20 at UniProt or InterPro

Protein Sequence (168 amino acids)

>DZA65_RS12515 GAF domain-containing protein (Dickeya dianthicola ME23)
MKKEQFYDELVRDLTALIAGEDRFLTILSNSSALLFERLDGVNWAGFYLLDGETLFLGPF
QGRPACVRIPAGKGVCGRAVAENRVQRVGDVHEFPGHIACDAASNAEIVLPLMVGGQLIG
VLDIDSTVHHRFDAVDEDGLNAVTTALCRQLSQSDVLTFINSLTLRQG