Protein Info for DZA65_RS12455 in Dickeya dianthicola ME23

Annotation: nitrate reductase molybdenum cofactor assembly chaperone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 TIGR00684: nitrate reductase molybdenum cofactor assembly chaperone" amino acids 9 to 161 (153 residues), 142.7 bits, see alignment E=4.7e-46 PF02613: Nitrate_red_del" amino acids 39 to 154 (116 residues), 41.5 bits, see alignment E=6.8e-15

Best Hits

Swiss-Prot: 64% identical to NARJ_ECO57: Nitrate reductase molybdenum cofactor assembly chaperone NarJ (narJ) from Escherichia coli O157:H7

KEGG orthology group: K00373, nitrate reductase 1, delta subunit [EC: 1.7.99.4] (inferred from 97% identity to ddd:Dda3937_03793)

Predicted SEED Role

"Respiratory nitrate reductase delta chain (EC 1.7.99.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.99.4)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.99.4

Use Curated BLAST to search for 1.7.99.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CRP2 at UniProt or InterPro

Protein Sequence (239 amino acids)

>DZA65_RS12455 nitrate reductase molybdenum cofactor assembly chaperone (Dickeya dianthicola ME23)
MISLRVIARLLEYPDAELWQQQQAMLEALEQADELPLRQSAQLLQFIADFYQGDLLDRQA
RYSELFDRGRALSLLLFEHVHGESRDRGQAMVDLLAQYREVGLELDCRELPDFLPLYLEY
LTLRDPQTVRDGLLDIAPILTLLAERLRQRDSEYALLPDLLLALAEFEPSRESVAAKVAQ
EARDDTPQALDAVWEEEQVRFLADAGCAPAQQTGHQRRFVDAVAPHYLNLDASRTKGDC