Protein Info for DZA65_RS12415 in Dickeya dianthicola ME23

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF00005: ABC_tran" amino acids 21 to 163 (143 residues), 130.7 bits, see alignment E=5.9e-42 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 36 to 354 (319 residues), 369.8 bits, see alignment E=5.7e-115 PF08402: TOBE_2" amino acids 280 to 358 (79 residues), 65.3 bits, see alignment E=4.4e-22

Best Hits

Swiss-Prot: 44% identical to POTA2_PSEAE: Spermidine/putrescine import ATP-binding protein PotA 2 (potA2) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 96% identity to ddd:Dda3937_04148)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CYF5 at UniProt or InterPro

Protein Sequence (364 amino acids)

>DZA65_RS12415 ABC transporter ATP-binding protein (Dickeya dianthicola ME23)
MKTYVSFKNIQKTYDGDRLVVKNLNLDIQEGEFLTMLGPSGSGKTTSLMMLAGFETPTQG
EILLRDTPLHNLPPHQRGIGMVFQNYALFPHMTVAENLAFPLAIRRMNRSDIKDKVDRVL
DRVKLTNLADRYPAQMSGGQQQRVALARALVFEPRLVLMDEPLGALDKQLREHMQLEIKE
LHRALELTVVYVTHDQSEAMTMSDRVAVFNDGIIQQMDSPSDIYERPQNAFVAQFIGENN
TLIGTQSGGNGDYYQAQLDDGTALHALKVRPSSPGRKIQLCIRPERVQVNASMLADGAQQ
VSARIQQFIYLGDHVRMMTEVAGQPQFMVKLPASAVNPDWQIGSEINLSWLPEHLRALDA
VATQ