Protein Info for DZA65_RS12355 in Dickeya dianthicola ME23

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 202 to 230 (29 residues), see Phobius details amino acids 250 to 273 (24 residues), see Phobius details PF12911: OppC_N" amino acids 16 to 50 (35 residues), 26.8 bits, see alignment 4.1e-10 PF00528: BPD_transp_1" amino acids 103 to 285 (183 residues), 88.6 bits, see alignment E=4.3e-29

Best Hits

Swiss-Prot: 40% identical to Y207_BRUME: Putative peptide transport system permease protein BMEII0207/BMEII0208 (BMEII0207/BMEII0208) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 98% identity to ddc:Dd586_1859)

MetaCyc: 37% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"ABC-type dipeptide/oligopeptide/nickel transport systems, permease components"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DA77 at UniProt or InterPro

Protein Sequence (289 amino acids)

>DZA65_RS12355 ABC transporter permease (Dickeya dianthicola ME23)
MKNTVSSRAGLSPEVRLFLRNPSGMTGVALLLLVVVMALAASWVYPGDPLDMVAQPFLWP
GQDPAFPLGTDSLGRDVAAGVVHGAQVSLQIGFSAVAVSLLIGMTVGASAGFFGGKVDRL
LVHVTELFQTFPTFLLVVVLVAIGQPSVTLISCAIGVASWPTIARLVRAEFRTWRESDFV
LAARSQGFSSLRIMAQEILPNALPSIIVTTSVMVASSILIESALSFLGFGDPNRVSWGSM
IGAGRESLRSAWFLTAIPGGALVLTVLALNLVGDALNDALNPRSRRERV