Protein Info for DZA65_RS12305 in Dickeya dianthicola ME23

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 14 to 112 (99 residues), 92.9 bits, see alignment E=7.2e-31 PF00528: BPD_transp_1" amino acids 35 to 218 (184 residues), 77.7 bits, see alignment E=5e-26

Best Hits

Swiss-Prot: 34% identical to GLNP_RICCN: Putative glutamine transport system permease protein GlnP (glnP) from Rickettsia conorii (strain ATCC VR-613 / Malish 7)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 98% identity to ddc:Dd586_1868)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CR22 at UniProt or InterPro

Protein Sequence (224 amino acids)

>DZA65_RS12305 amino acid ABC transporter permease (Dickeya dianthicola ME23)
MHYQWNFGFIWQQLPVLLRGLGVTLELWLLAGIGGTLLGLALGIARTARRRAVRLPVIAF
VELFRNTPVLIQLIWFYYAMPVLTGLQLSTFGAAVLALTLYTAAYSTEIFRAGLQSMEQG
QWEGAKALGMSYPLALRRVILPQVLQRMLPALTNRLIELAKVTSLASMLAVNELMYQGRL
LSSDTYRPLEILTVVALFYFVLIWPGSYLAARLERRWRSPLSTR