Protein Info for DZA65_RS12290 in Dickeya dianthicola ME23

Annotation: pyridoxal-phosphate dependent enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00291: PALP
  • amino acids 13 to 305 (293 residues), 260.3 bits, E=2.5e-81
• PF00571: CBS
  • amino acids 348 to 392 (45 residues), 31.7 bits, 1.6e-11
  • amino acids 403 to 453 (51 residues), 27.4 bits, 3.4e-10

Best Hits

KEGG orthology group: K01697, cystathionine beta-synthase [EC: 4.2.1.22] (inferred from 94% identity to ddc:Dd586_1871)

Predicted SEED Role

"Cystathionine beta-synthase (EC 4.2.1.22)" in subsystem Cysteine Biosynthesis or Glycine and Serine Utilization or Methionine Biosynthesis or Methionine Degradation (EC 4.2.1.22)

MetaCyc Pathways

• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (9/10 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (5/6 steps found)
• homocysteine and cysteine interconversion (3/4 steps found)
• hydrogen sulfide biosynthesis II (mammalian) (4/6 steps found)
• L-cysteine biosynthesis III (from L-homocysteine) (1/2 steps found)
• taurine biosynthesis III (1/3 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (2/5 steps found)
• superpathway of L-methionine salvage and degradation (6/16 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.22

Sequence Analysis Tools

See A0A385Y2Y7 at UniProt or InterPro

Protein Sequence (459 amino acids)

>DZA65_RS12290 pyridoxal-phosphate dependent enzyme (Dickeya dianthicola ME23)
MPIPTSVPTSVLSLIGNTPLLELTQFDTGPCRLFAKLENQNPGGSIKDRVALSMIEAAEQ
QGKLQPGGTLIEATAGNAGLGLALVAALKGYRLILVVPDKMSREKIFHLRALGVDVRQTR
SDVAKGHPDYYQDYAQRLANETPGAFYIDQFNNPANPLAHYRTTAQELWRQMENDIDAIV
VGVGSGGTLGGLSRYFAEASPKTELVLADPAGSILTDYVRQGTTGEAGSWLVEGIGEDFL
PALANFSQVKHAYAISDQESFQAARALLHKEGVLAGSSSGTLLAAALRYCRAQTEPRRVV
TLICDSGNKYLSKMFNDYWMIEQGLLQRPKQGDLRDLITYRHNEGATVSVSPDDSLAIVH
ARMRLYDISQLPVLEHDRVVGVIDEWDLLNNLKANPRHFSLTARDAMTDQVNTLQKDASF
DQLLTTFDHGHVAVILDGQRFLGLITRTDVLNHWRHRVR