Protein Info for DZA65_RS12290 in Dickeya dianthicola ME23

Annotation: pyridoxal-phosphate dependent enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 PF00291: PALP" amino acids 13 to 305 (293 residues), 260.3 bits, see alignment E=2.5e-81 PF00571: CBS" amino acids 348 to 392 (45 residues), 31.7 bits, see alignment 1.6e-11 amino acids 403 to 453 (51 residues), 27.4 bits, see alignment 3.4e-10

Best Hits

KEGG orthology group: K01697, cystathionine beta-synthase [EC: 4.2.1.22] (inferred from 94% identity to ddc:Dd586_1871)

Predicted SEED Role

"Cystathionine beta-synthase (EC 4.2.1.22)" in subsystem Cysteine Biosynthesis or Glycine and Serine Utilization or Methionine Biosynthesis or Methionine Degradation (EC 4.2.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y2Y7 at UniProt or InterPro

Protein Sequence (459 amino acids)

>DZA65_RS12290 pyridoxal-phosphate dependent enzyme (Dickeya dianthicola ME23)
MPIPTSVPTSVLSLIGNTPLLELTQFDTGPCRLFAKLENQNPGGSIKDRVALSMIEAAEQ
QGKLQPGGTLIEATAGNAGLGLALVAALKGYRLILVVPDKMSREKIFHLRALGVDVRQTR
SDVAKGHPDYYQDYAQRLANETPGAFYIDQFNNPANPLAHYRTTAQELWRQMENDIDAIV
VGVGSGGTLGGLSRYFAEASPKTELVLADPAGSILTDYVRQGTTGEAGSWLVEGIGEDFL
PALANFSQVKHAYAISDQESFQAARALLHKEGVLAGSSSGTLLAAALRYCRAQTEPRRVV
TLICDSGNKYLSKMFNDYWMIEQGLLQRPKQGDLRDLITYRHNEGATVSVSPDDSLAIVH
ARMRLYDISQLPVLEHDRVVGVIDEWDLLNNLKANPRHFSLTARDAMTDQVNTLQKDASF
DQLLTTFDHGHVAVILDGQRFLGLITRTDVLNHWRHRVR