Protein Info for DZA65_RS12210 in Dickeya dianthicola ME23

Annotation: type III secretion system export apparatus subunit SctV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 235 to 262 (28 residues), see Phobius details amino acids 296 to 321 (26 residues), see Phobius details amino acids 364 to 382 (19 residues), see Phobius details TIGR01399: type III secretion protein, HrcV family" amino acids 18 to 689 (672 residues), 842.2 bits, see alignment E=1.6e-257 PF00771: FHIPEP" amino acids 30 to 680 (651 residues), 682 bits, see alignment E=5.1e-209

Best Hits

Swiss-Prot: 79% identical to HRPI_ERWAM: Harpin secretion protein HrpI (hrpI) from Erwinia amylovora

KEGG orthology group: K03230, type III secretion protein SctV (inferred from 97% identity to ddd:Dda3937_00609)

Predicted SEED Role

"Type III secretion inner membrane channel protein (LcrD,HrcV,EscV,SsaV)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y053 at UniProt or InterPro

Protein Sequence (700 amino acids)

>DZA65_RS12210 type III secretion system export apparatus subunit SctV (Dickeya dianthicola ME23)
MAVLIVWLNRFAMSAMQRSEVVGAVIVMAIVFMMIIPLPTGLIDVLIAFNICISSLLIVL
AMYLPKPLAFSTFPAVLLLTTMFRLALSISTTRQILLQQDAGHVVEAFGNFVVGGNLAVG
LVIFMILTVVNFLVITKGSERVAEVAARFTLDAMPGKQMSIDSDLRAGLIDAQQARQRRE
NLAKESQLFGAMDGAMKFVKGDAIASLVIVFINMIGGFAIGVLQNGMAAGDAMHIYSVLT
IGDGLIAQIPALLISLTAGMIITRVSADGQKTDNNIGREIAEQLTSQPKAWIISSVGMLG
FALLPGMPTLVFLIISLVSLGSGLFQLWRVKQSGLQDALLADDSLPAEQNGYQDLRRFNP
TRAYLLQFHTVWQGAAAAAVLVQDIRRLRNRLVYHFGFTLPSFDIEFNPNMPEDEFRFCV
YEIPQLRASFGVPLLAVPRGQLPEATLDDGMMLGLPARDEHHLLWLTPEHPLLQQPELSP
WSPTVLILSRMENAIHRSGAQFIGLQETKSILAWLESEQPELAQELQRIMPLSRFASVLQ
RLASERVPLRSVRPIAEALIEIGQHERDINALTDYVRLELKAQICHQYSQDDSLTVWLLT
PETEELLRDALRQTQNDTFFALTQEYAATLLGQLRHAFPPMVPPSALILVAQDLRSPLRI
LLQDEFHHVPVLSFTELESHLSINVAGRIDLQDRVDPFNA