Protein Info for DZA65_RS12205 in Dickeya dianthicola ME23

Annotation: type III secretion system gatekeeper subunit SctW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 TIGR02568: type III secretion regulator YopN/LcrE/InvE/MxiC" amino acids 43 to 282 (240 residues), 148.4 bits, see alignment E=3e-47 PF07201: HrpJ" amino acids 56 to 223 (168 residues), 151.4 bits, see alignment E=3.1e-48 PF09059: TyeA" amino acids 295 to 362 (68 residues), 22.4 bits, see alignment E=1.1e-08 TIGR02511: type III secretion effector delivery regulator, TyeA family" amino acids 310 to 368 (59 residues), 36.8 bits, see alignment E=3.7e-13

Best Hits

KEGG orthology group: K04058, type III secretion protein SctW (inferred from 97% identity to ddd:Dda3937_00608)

Predicted SEED Role

"type III secretion protein HrpJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XYW9 at UniProt or InterPro

Protein Sequence (389 amino acids)

>DZA65_RS12205 type III secretion system gatekeeper subunit SctW (Dickeya dianthicola ME23)
MISLNNVSSVLTTSSATTANDIDEQEPVSSPVKTSEARPSHDKTLHDAMEEVAASFGEQV
ERKSKALNRRQISQPQSRMLANIERIEKLTELFQLLENPKHPTLDQQIRQMQVLLRQSSP
PPVEAIMQAAGGDAARSDIVLRHVLSQAQQQQDATLAQSTSQSLAQLHQEKGPEVRAGLN
TAAAISLFSTDPNQKQALRDLYYQRIVHQQSPSALLDALLERFDAQHFAAGLRTLQRALA
ADIASLAPSISKNVLSKMLSSLNDSRQLSHTLSASQSLLARLASRMPECALGAVELTRRL
IGLSANGAYARDLHNLGREVAGQDTQRQLLFFNGLLPLVNDLPHPLWRDAKNRLTALQLI
RSLIGDFAQYEKQQQDDAKPMNDRSRNKG