Protein Info for DZA65_RS12195 in Dickeya dianthicola ME23

Annotation: PAS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 TIGR00229: PAS domain S-box protein" amino acids 26 to 137 (112 residues), 37 bits, see alignment E=1.7e-13 amino acids 141 to 269 (129 residues), 34 bits, see alignment E=1.4e-12 PF13188: PAS_8" amino acids 29 to 74 (46 residues), 24.5 bits, see alignment 5.9e-09 amino acids 146 to 203 (58 residues), 24.4 bits, see alignment 6.4e-09 PF13426: PAS_9" amino acids 30 to 131 (102 residues), 32.6 bits, see alignment E=2.6e-11 amino acids 165 to 261 (97 residues), 32 bits, see alignment E=3.9e-11 PF00989: PAS" amino acids 145 to 259 (115 residues), 37.9 bits, see alignment E=4.8e-13 PF08448: PAS_4" amino acids 150 to 261 (112 residues), 63.3 bits, see alignment E=7.3e-21 PF07730: HisKA_3" amino acids 290 to 356 (67 residues), 65 bits, see alignment E=2.2e-21 PF02518: HATPase_c" amino acids 398 to 486 (89 residues), 49 bits, see alignment E=2.3e-16

Best Hits

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_03347)

Predicted SEED Role

"Nitrate/nitrite sensor protein (EC 2.7.3.-)" in subsystem Nitrate and nitrite ammonification (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XY19 at UniProt or InterPro

Protein Sequence (488 amino acids)

>DZA65_RS12195 PAS domain-containing protein (Dickeya dianthicola ME23)
MLYTPISPQPHHPDDVPPLELVDFAFSRINDAIYIVNDMEQFCYANDEACRMLGYSRREF
RHLRIQDIDLGWTMEETNRHWGDPRCWKRGLTFETRHKARFDIVLPVEVSVNHFLHKGRK
YSMCVVRDIRERKHIEQLAYAREQEFRALVENTPDLIARFDPQLNCQYANPATLAHLRFT
AEQLRGRRLTELLPNARSAQRILQLVQMVVDTESSVEGELEEDIGATPTRHRVIHHIRCV
PEFDQSGKLTSILTVGRDITAMRYAEKKLEDSHMQLRLLARQREISREEERKHIAREIHD
ELGQHLTSMRMSLSLMRMQFARDNPHMLTQLQNLMALSDKTIQVVRYVATRLRPNVLDMG
LTPALEWLRDDFIRQYRCPCLLQAPEPEVTLNDECATAAFRVVQESLTNIARYAEATQVA
ISLENREGLIVLSVRDNGKGFDAHARKPHAFGLMSMKERGRMLGGEVVIESQPGTGTLVR
LTFPQDTA