Protein Info for DZA65_RS12150 in Dickeya dianthicola ME23

Annotation: phospholipase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

Swiss-Prot: 94% identical to PLCA_DICCH: Extracellular phospholipase C (plcA) from Dickeya chrysanthemi

KEGG orthology group: None (inferred from 98% identity to ddd:Dda3937_04211)

Predicted SEED Role

"Extracellular phospholipase C (EC 3.1.-.-)" (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

See A0A385XY08 at UniProt or InterPro

Protein Sequence (349 amino acids)

>DZA65_RS12150 phospholipase (Dickeya dianthicola ME23)
MEKVLIWFCGTGTTKQDFLANVEISGFSAVVAIDGIGTAAMLTKTQALAKRASWGGSFVG
MSETLGVLYDQVNGYDDRAGVVTLDSLFPLVDYLKTLKEYQLVVGGHSRGAAVGLTEFLA
ELYHLAVQNQAAGVWANAKTIRLVVVDPVQGQQDSDKDTNAFNAILNDKTLAQILAELET
KWFGGRDVFDTLVYSARYDARSSFAFDSRWYRFITEQMGKQAGPAKRAKLVMAGFRHSAP
VSKEDEISALYQGKGVAPIAFLQQLVSFDPNWEQSARLLSQIENGYLDQLAAGAKTDLIS
QLDKQTSLLSYGITGLIGGKSLQKTLSTDNPQKPEYRRFYRYQYGATTF