Protein Info for DZA65_RS12005 in Dickeya dianthicola ME23

Annotation: RNA 2'-phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 PF01885: PTS_2-RNA" amino acids 4 to 171 (168 residues), 163.6 bits, see alignment E=2.6e-52

Best Hits

Swiss-Prot: 86% identical to KPTA_PECAS: Probable RNA 2'-phosphotransferase (kptA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K07559, putative RNA 2'-phosphotransferase [EC: 2.7.1.-] (inferred from 92% identity to pwa:Pecwa_0438)

Predicted SEED Role

"RNA:NAD 2'-phosphotransferase" in subsystem tRNA splicing

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XXY1 at UniProt or InterPro

Protein Sequence (179 amino acids)

>DZA65_RS12005 RNA 2'-phosphotransferase (Dickeya dianthicola ME23)
MSKKNTDISKFLSYILRHQPEAIGLSLDKEGWAIISDLILCAVKEGYTLDNSLIHSIVDN
SDKKRFTISDDGLRIRAAQGHSSQQVNITYEEKTPPEFLYHGTATRFLISIRAQGLHAKD
RQYVHLSADEETAIQVGSRHGKPIVLKIKALTMHEQGFKFFQADNGVWLTKSVPPSAFI