Protein Info for DZA65_RS11845 in Dickeya dianthicola ME23

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 723 PF01590: GAF" amino acids 31 to 155 (125 residues), 55.8 bits, see alignment E=3e-18 PF13185: GAF_2" amino acids 33 to 155 (123 residues), 31.2 bits, see alignment E=9.3e-11 TIGR00229: PAS domain S-box protein" amino acids 169 to 292 (124 residues), 69.7 bits, see alignment E=2.6e-23 PF13188: PAS_8" amino acids 173 to 221 (49 residues), 34.8 bits, see alignment 4.3e-12 PF00989: PAS" amino acids 174 to 282 (109 residues), 43.4 bits, see alignment E=1.2e-14 PF08448: PAS_4" amino acids 180 to 287 (108 residues), 35.1 bits, see alignment E=5.5e-12 PF13426: PAS_9" amino acids 183 to 284 (102 residues), 51.5 bits, see alignment E=4.3e-17 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 295 to 451 (157 residues), 144.7 bits, see alignment E=2.1e-46 PF00990: GGDEF" amino acids 296 to 448 (153 residues), 160.7 bits, see alignment E=1e-50 PF00563: EAL" amino acids 473 to 704 (232 residues), 214.3 bits, see alignment E=6.9e-67

Best Hits

KEGG orthology group: None (inferred from 98% identity to ddd:Dda3937_03689)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D1B2 at UniProt or InterPro

Protein Sequence (723 amino acids)

>DZA65_RS11845 EAL domain-containing protein (Dickeya dianthicola ME23)
MSRAPANKDEKSRLEALSEYGISKPLSDPGFDNLINLAANVFNVPIVLISLVEEERQLFA
ASVGMSVCETSRDESFCAHAILKKRIMVIPDTRKDPRFQDNPLVTGEPHIRFYAGIPLRT
PSGFPIGVLCIIDNKPRPSLSARDAHNLQDFAALVMDKLEMRRLDLARRASQARFESIAE
SSPDAILCVNDRGTITFWNESAEKMLEYNRDQIIGEHISVIVPDMFVVQLHHLATDKTAI
FKGSSIELDTRALPGTLIPTELTVSMWHDNNQTRYGIILRDITERQRYEERLFLQAHRDP
LTGLANRTLLTSTLEQVLKNGEPTAIMIIDLDGFKDINDSLGHTSGDEILSSVAKRLQNN
VCSGDLVARMGGDEFAILLPKQNDESQVAILAEKIIYDISQAVSVDDKQINTSASIGLVM
YPAHGTTVQDLLTSADLALYQAKADGRNCYRFFTRELREVFQARHAFQLEFIRAYEQEEF
EVFYQPQVSLVNSKVVGAEALLRWRHPYKGLLGPAAFMSALERGPWAERIGDWVVRSACQ
QASDWCRSGAGNFRISINLFAAQFHSGMLAQKIKEVLTQTGLKPGALELEITENIILRHD
ENMMKPLNELRNSGVGIAFDDYGTGYASLSMLKHYPVTRLKIDQTFVRAMCESAPDAAIV
RAILYLGKSFGLDVIAEGVETQEQSERLLNKGCEQAQGYLFGRPMPAEEFEKLLGLEDAP
LAQ