Protein Info for DZA65_RS11735 in Dickeya dianthicola ME23

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 205 to 228 (24 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 118 to 293 (176 residues), 58.9 bits, see alignment E=2.8e-20

Best Hits

KEGG orthology group: K10194, oligogalacturonide transport system permease protein (inferred from 98% identity to ddc:Dd586_1960)

Predicted SEED Role

"Putative sugar ABC transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CHV7 at UniProt or InterPro

Protein Sequence (300 amino acids)

>DZA65_RS11735 carbohydrate ABC transporter permease (Dickeya dianthicola ME23)
MADIHSPLSAQAIAAAEVRRTLRREKISASMRYIILLAVGILMLYPLAWMFSASFKPNHE
IFTTLSLWPTHATWDGFINGWKTGTEYNFGHYMINTFKYVIPKVALTVISSTIVAYGFAR
FEIPWKNFWFATLIATMLLPSTVLLIPQYIMFREMGMLNSYLPLYVPVAFATQGFFVFML
IQFLRGVPRDMEEAAQIDGCNSWQVLWYVVVPILKPAIISVALFQFMWSMNDFIGPLIYV
YSVDKYPIALALKMSIDVTEGAPWNEILAMASISILPSIIIFFMAQRYFVQGVTSSGIKG