Protein Info for DZA65_RS11705 in Dickeya dianthicola ME23

Annotation: yfeABCD regulator yfeE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 153 to 175 (23 residues), see Phobius details PF14002: YniB" amino acids 15 to 179 (165 residues), 266.8 bits, see alignment E=3.6e-84

Best Hits

Swiss-Prot: 60% identical to YFEE_YERPE: Putative YfeABCD regulator YfeE (yfeE) from Yersinia pestis

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_00018)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CYP8 at UniProt or InterPro

Protein Sequence (182 amino acids)

>DZA65_RS11705 yfeABCD regulator yfeE (Dickeya dianthicola ME23)
MTYRQAGLFAVIKRIAGWVIFLPALLSTIISLANLIHAFTEKKQGINGVMQDFLHLVVEV
LRFNTPFLNIFWYNSPVPEFARLSASATIMFWLIYLLMFVGLALQVSGSRLSRQVKHIRE
GLEDQLILEKVKGDEGKTREELESRVALPRHTILLQFFPLYILPVVVAVIGYLTLKTVGI
LA