Protein Info for DZA65_RS11565 in Dickeya dianthicola ME23

Annotation: disulfide bond formation protein DsbB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 transmembrane" amino acids 13 to 37 (25 residues), see Phobius details amino acids 49 to 73 (25 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details PF02600: DsbB" amino acids 12 to 159 (148 residues), 161.5 bits, see alignment E=9.8e-52

Best Hits

Swiss-Prot: 82% identical to DSBB_PECAS: Disulfide bond formation protein B (dsbB) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K03611, disulfide bond formation protein DsbB (inferred from 100% identity to ddd:Dda3937_02924)

MetaCyc: 69% identical to protein thiol:quinone oxidoreductase DsbB (Escherichia coli K-12 substr. MG1655)
RXN-19950 [EC: 1.8.5.9]

Predicted SEED Role

"Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.5.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CYE0 at UniProt or InterPro

Protein Sequence (176 amino acids)

>DZA65_RS11565 disulfide bond formation protein DsbB (Dickeya dianthicola ME23)
MLRFLNRCSRGRGAWLLMAFTALAFELIALYFQYVMMLKPCVLCIYQRTALYGVMAAGLV
GAVAPGTLLRYPAIGLWIYSAWEGLSLAIKHTNIQLHPSPFVTCDFFVSFPSWLPLDKWL
PAIFTATGDCAERQWSFLSMEMPQWMIVIFGAYLLVAVLVLIAQPFRPKRRDLFGR