Protein Info for DZA65_RS11565 in Dickeya dianthicola ME23
Annotation: disulfide bond formation protein DsbB
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 82% identical to DSBB_PECAS: Disulfide bond formation protein B (dsbB) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
KEGG orthology group: K03611, disulfide bond formation protein DsbB (inferred from 100% identity to ddd:Dda3937_02924)MetaCyc: 69% identical to protein thiol:quinone oxidoreductase DsbB (Escherichia coli K-12 substr. MG1655)
RXN-19950 [EC: 1.8.5.9]
Predicted SEED Role
"Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange
MetaCyc Pathways
- periplasmic disulfide bond formation (1/3 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.8.5.9
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A3A4CYE0 at UniProt or InterPro
Protein Sequence (176 amino acids)
>DZA65_RS11565 disulfide bond formation protein DsbB (Dickeya dianthicola ME23) MLRFLNRCSRGRGAWLLMAFTALAFELIALYFQYVMMLKPCVLCIYQRTALYGVMAAGLV GAVAPGTLLRYPAIGLWIYSAWEGLSLAIKHTNIQLHPSPFVTCDFFVSFPSWLPLDKWL PAIFTATGDCAERQWSFLSMEMPQWMIVIFGAYLLVAVLVLIAQPFRPKRRDLFGR