Protein Info for DZA65_RS11550 in Dickeya dianthicola ME23

Annotation: fatty acid metabolism transcriptional regulator FadR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 TIGR02812: fatty acid metabolism transcriptional regulator FadR" amino acids 2 to 236 (235 residues), 383.6 bits, see alignment E=1.9e-119 PF00392: GntR" amino acids 11 to 71 (61 residues), 69.6 bits, see alignment E=1.4e-23 PF07840: FadR_C" amino acids 72 to 234 (163 residues), 238.9 bits, see alignment E=2.7e-75

Best Hits

Swiss-Prot: 83% identical to FADR_PECCP: Fatty acid metabolism regulator protein (fadR) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03603, GntR family transcriptional regulator, negative regulator for fad regulon and positive regulator of fabA (inferred from 95% identity to ddc:Dd586_1994)

Predicted SEED Role

"Transcriptional regulator for fatty acid degradation FadR, GntR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D7P3 at UniProt or InterPro

Protein Sequence (239 amino acids)

>DZA65_RS11550 fatty acid metabolism transcriptional regulator FadR (Dickeya dianthicola ME23)
MVIKAQSPAGFAEEYIIESIWNNHFPPGSILPAERELSELIGVTRTTLREVLQRLSRDGW
LTIRHGKPTKINNFWETSGLNILETLARLDHDSVPQLIDNLLAVRTNIAGIFIRTAIRLH
PAKSAEILKLAESVKDASDAYAELDYNVFRGLAFASGNPIYGLIINGLKGLYIRVGRYYF
SNPEARKTALAFYQRLESLSRDGLYEQVPDVIRQYGKESGALWHSMQNSIPRDLAEGRG