Protein Info for DZA65_RS11535 in Dickeya dianthicola ME23

Annotation: extracellular solute-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF13531: SBP_bac_11" amino acids 51 to 298 (248 residues), 25.9 bits, see alignment E=1.2e-09 PF01547: SBP_bac_1" amino acids 64 to 297 (234 residues), 49.8 bits, see alignment E=8e-17 PF13343: SBP_bac_6" amino acids 110 to 304 (195 residues), 28.7 bits, see alignment E=1.3e-10

Best Hits

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 97% identity to dze:Dd1591_2013)

Predicted SEED Role

"ABC transporter, substrate binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CYV4 at UniProt or InterPro

Protein Sequence (373 amino acids)

>DZA65_RS11535 extracellular solute-binding protein (Dickeya dianthicola ME23)
MQYTGKYLKKTALMLTMMAGISTWQSQAAVTPDTRSLDEIYQSALKEGGTVTVYAGGDVQ
SQQTGFKQAFENRFPGIKLNVIVDYSKYHDARIDNQLATDTLIPDVVQLQTVQDFPRWKK
QGVLLNYKPVGWDKVYPEFRDADGAWIGAYVIAFSNLVNTQLLDEKSWPREANDYLRPDL
KGNLILAYPNDDDAVLFWYKLVVDKYGWEFVEKLQEQDPVYVRGTNVPGAQIATGKYSAT
FTSSGALAPAAGSVTRFVLPKADPFVSWAQRAAIFKQAKHPESAKLYLSWLLDPQTQTQV
SRMWSVRTDVAPPAGYKPIWEYSNTRPQAFADFMSDRGAVERFRAQMSLYVGEAKGDPTP
GWLGLRPDAPLAN