Protein Info for DZA65_RS11240 in Dickeya dianthicola ME23

Annotation: HlyD family type I secretion periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 11 to 432 (422 residues), 395.9 bits, see alignment E=1.2e-122 PF25973: BSH_CzcB" amino acids 59 to 305 (247 residues), 32.2 bits, see alignment E=1.2e-11 PF25994: HH_AprE" amino acids 91 to 275 (185 residues), 133.5 bits, see alignment E=1.5e-42 PF26002: Beta-barrel_AprE" amino acids 320 to 409 (90 residues), 92.8 bits, see alignment E=1.8e-30

Best Hits

Swiss-Prot: 96% identical to PRTE_DICCH: Proteases secretion protein PrtE (prtE) from Dickeya chrysanthemi

KEGG orthology group: K12537, protease secretion protein HasE (inferred from 96% identity to ddd:Dda3937_01652)

Predicted SEED Role

"ABC-type protease exporter, membrane fusion protein (MFP) family component PrtE/AprE" in subsystem Protein secretion by ABC-type exporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CZ20 at UniProt or InterPro

Protein Sequence (432 amino acids)

>DZA65_RS11240 HlyD family type I secretion periplasmic adaptor subunit (Dickeya dianthicola ME23)
MRDRAGRDEERALRLGWWLVLAGFGGFLLWALLAPLDKGVAVQGNVVVSGNRKVIQHMQG
GIVDRIQAKEGDRVAAGQVLLTLNAVDARTTSEGLGSQYDQLIAREARLLAEQRNQSSLA
ATPRLTQARQRTEMAAIITLQEDLLHSRQQALKLETDGVRASIDGMETSLGALQKVMTSK
QSEQSTLSQQLQGLRPLAADNYVPRNKMLETERLFAQVSGELAQTSGEVGRTRRDIQQQK
LRIAQRQQEYDKEVNSELSDVQAKLNEVISQREKADFNLANVQVRAPVAGTVVDMKIFTE
GGVIAPGQVMMEIVPEDQPLLVDGRIPVEMVNKVWSGLPVELQFTAFNQSTTPRVPGTVT
LLSADRLVDEKDGTPYYSLRIQVSEEGKRSLHGLEIKPGMPVQGFVRTGERSFINYLFKP
LMDRMHLALTEE