Protein Info for DZA65_RS11100 in Dickeya dianthicola ME23

Annotation: bile acid:sodium symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 56 (19 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 128 to 153 (26 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 230 to 253 (24 residues), see Phobius details amino acids 282 to 302 (21 residues), see Phobius details PF13593: SBF_like" amino acids 10 to 318 (309 residues), 363.3 bits, see alignment E=1.2e-112 PF01758: SBF" amino acids 44 to 218 (175 residues), 40.6 bits, see alignment E=2.3e-14

Best Hits

Swiss-Prot: 67% identical to YFEH_ECOLI: Putative symporter YfeH (yfeH) from Escherichia coli (strain K12)

KEGG orthology group: K14347, solute carrier family 10 (sodium/bile acid cotransporter), member 7 (inferred from 95% identity to dze:Dd1591_2144)

Predicted SEED Role

"Putative membrane protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C777 at UniProt or InterPro

Protein Sequence (331 amino acids)

>DZA65_RS11100 bile acid:sodium symporter (Dickeya dianthicola ME23)
MAWLQRLKIDNFLLILIAVVITASIFPCEGVAKVFFENLTNVAIALLFFMHGAKLSRNAI
TVGMGHWRLHLVVFASTFILFPLLGIGMAFLSPQILTPGLYLGFLYLCALPATVQSAIAF
TSMAGGNVAAAICSASASSILGVFLSPVLVGLLMHTQGGQTDTLHAIGAIIMQLMVPFVI
GHLSRPLIGGWVDRHRKLINITDRSSILLVVYVAFSEAVVQGIWHQINGWSLLAVVACSL
VLLGIVLVCTTLAARKLGFSTQDEITIVFCGSKKSLANGIPMANVLFPAAAVGAMVLPLM
IFHQIQLMVCATLAQRYANRAVPAGDEIAGK