Protein Info for DZA65_RS11090 in Dickeya dianthicola ME23

Annotation: arabinose operon transcriptional regulator AraC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details PF02311: AraC_binding" amino acids 27 to 162 (136 residues), 81.5 bits, see alignment E=7.5e-27 PF12833: HTH_18" amino acids 206 to 284 (79 residues), 75.2 bits, see alignment E=6.1e-25 PF00165: HTH_AraC" amino acids 244 to 283 (40 residues), 37.2 bits, see alignment 3.6e-13

Best Hits

Swiss-Prot: 88% identical to ARAC_DICCH: Arabinose operon regulatory protein (araC) from Dickeya chrysanthemi

KEGG orthology group: None (inferred from 98% identity to ddd:Dda3937_00602)

Predicted SEED Role

"Arabinose operon regulatory protein" in subsystem L-Arabinose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CEV5 at UniProt or InterPro

Protein Sequence (316 amino acids)

>DZA65_RS11090 arabinose operon transcriptional regulator AraC (Dickeya dianthicola ME23)
MYHRMAHESQPNPLLPGYAFNAYLVAGLTPILAGGPLDFFIDRPDGMKGYIINLTIKGQG
KVLDGDDTFFCNPGDLLLFPPRSRHYYGRAPGSDNWYHRWVYFRPRAYWADWLEWHSKGC
DVGRLTLSSTGLLQEFDKLFANIEQTHRSGRRFSEELAMNLLERLLLRAMEEDPQSPQRI
MDPRVIEACQFITGNLAGELRIDEVARHVCLSPSRLAHLFREQVGVNILRWREDQRVIRA
KLLLQTTQESIAAVGRVVGYDDQLYFSRVFRKRVGVSPSDFRRRNSEIHHPTLEKPAEAA
LWRGESLAPHPWVVTP