Protein Info for DZA65_RS11040 in Dickeya dianthicola ME23

Annotation: electron transport complex subunit RsxD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 214 to 237 (24 residues), see Phobius details amino acids 244 to 262 (19 residues), see Phobius details amino acids 268 to 288 (21 residues), see Phobius details amino acids 300 to 318 (19 residues), see Phobius details amino acids 324 to 342 (19 residues), see Phobius details PF03116: NQR2_RnfD_RnfE" amino acids 6 to 348 (343 residues), 390.1 bits, see alignment E=3.9e-121 TIGR01946: electron transport complex, RnfABCDGE type, D subunit" amino acids 8 to 349 (342 residues), 460 bits, see alignment E=2.4e-142

Best Hits

Swiss-Prot: 73% identical to RNFD_PECCP: Ion-translocating oxidoreductase complex subunit D (rnfD) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03614, electron transport complex protein RnfD (inferred from 97% identity to ddd:Dda3937_00592)

Predicted SEED Role

"Electron transport complex protein RnfD" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CEU5 at UniProt or InterPro

Protein Sequence (350 amino acids)

>DZA65_RS11040 electron transport complex subunit RsxD (Dickeya dianthicola ME23)
MAFRIAPSPFTHNRQSTRNIMRWVLAACVPGIAAQAWFFGYGNLIQLALASVTALVTEAA
ILSSRKRPVLETLQDSSALLTAVLLAISLPPFTPWWMVVLGTTFAIIIAKQLYGGLGQNP
FNPAMIGYVVLLISFPVQMTSWLPPDGLQAAPVGFRDALAAIFTGHGTAGQTLQQLIQGV
DGVSQATPLDAFKTGLRSGHQPEVLLHQPLFGGVLAGLGWQWINLAFLAGGLFMLLLRVI
HWQIPFSFLLALSVCALAGWHLHPDVSAPPLLHLFSGATMLGAFFIATDPVTASTTPRGR
LIFGTLIGVLVWTIRTYGGYPDGVAFAVLLANITVPLIDYFTKPRAYGHR