Protein Info for DZA65_RS10970 in Dickeya dianthicola ME23

Annotation: PHP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF02811: PHP" amino acids 15 to 111 (97 residues), 47.4 bits, see alignment E=1.4e-16

Best Hits

Swiss-Prot: 71% identical to RNAAM_ECOLI: 5'-3' exoribonuclease (yciV) from Escherichia coli (strain K12)

KEGG orthology group: K07053, (no description) (inferred from 96% identity to ddd:Dda3937_00578)

MetaCyc: 71% identical to RNase AM (Escherichia coli K-12 substr. MG1655)
RXN-16009 [EC: 3.1.3.97]; 3.1.13.- [EC: 3.1.3.97]; RXN-24047 [EC: 3.1.3.97]

Predicted SEED Role

"COG0613, Predicted metal-dependent phosphoesterases (PHP family)"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.97

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y2A2 at UniProt or InterPro

Protein Sequence (290 amino acids)

>DZA65_RS10970 PHP domain-containing protein (Dickeya dianthicola ME23)
MPDELPVSPTYPLYDLHSHTTVSDGLLTPTELVQRAVSMRVSVLAITDHDTTAALDEAYT
AIQRQALPLRLIAGVEISTVWENHEIHIVGLGLDCRHPVLTLLLQQQVQYREQRAGQIAQ
RLEKALIPDALAGASRLAEGGMITRGHFARYLVELGKAATVAQVFKKYLAKGKTGYVPPQ
WCTIQQAVDAIRQSGGVAVLAHPGRYDLTAKWLKRLIGHFAECGGEAMEVAQCQQAPDER
SYLARYAQDYHLLGSQGSDFHQPCAWIELGRKLWLPAGVEPVWQHPALAG