Protein Info for DZA65_RS10935 in Dickeya dianthicola ME23

Annotation: porin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF06178: KdgM" amino acids 14 to 243 (230 residues), 243.2 bits, see alignment E=1.3e-76

Best Hits

Swiss-Prot: 59% identical to KDGM_DICD3: Oligogalacturonate-specific porin KdgM (kdgM) from Dickeya dadantii (strain 3937)

KEGG orthology group: None (inferred from 93% identity to ddd:Dda3937_00571)

Predicted SEED Role

"N-acetylneuraminic acid outer membrane channel protein NanC" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CXQ7 at UniProt or InterPro

Protein Sequence (243 amino acids)

>DZA65_RS10935 porin (Dickeya dianthicola ME23)
MKFKILTMMVASVVSMSSMAVTFDYRHEMKDTQNANHQDRLLISHRFENGFGLSSEVKWK
QSSNDNTPNKPYDEQVSNGTEVTASYLYKFNKMFNAEAGFNLVSDNTGNKYRPYIKGGIN
FTDDIYYTLRYRPFYQRYSSTINTATPAEATNMKGYTITSVLGYKFLDNFTVEYELEYNK
NTKAGNFGYIYDNDNDNLTHDVKLAYKIDKNWTPYIQVANVEGPSKTTDERQTRYRVGVL
YNF