Protein Info for DZA65_RS10600 in Dickeya dianthicola ME23

Annotation: DNA polymerase III subunit theta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 76 PF06440: DNA_pol3_theta" amino acids 2 to 71 (70 residues), 126.5 bits, see alignment E=1.3e-41

Best Hits

Swiss-Prot: 60% identical to HOLE_ECOL6: DNA polymerase III subunit theta (holE) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02345, DNA polymerase III subunit theta [EC: 2.7.7.7] (inferred from 97% identity to ddd:Dda3937_03567)

MetaCyc: 60% identical to DNA polymerase III subunit theta (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA polymerase III theta subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XY11 at UniProt or InterPro

Protein Sequence (76 amino acids)

>DZA65_RS10600 DNA polymerase III subunit theta (Dickeya dianthicola ME23)
MGYNLAELPYEEMEKVNVDLAASGVAFRERYNMPVILDEIEQQQPAHLRTYFRERVSDYR
EMSRQFSTLPYDPNSK