Protein Info for DZA65_RS10585 in Dickeya dianthicola ME23

Annotation: bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 TIGR01182: 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase" amino acids 9 to 209 (201 residues), 283.7 bits, see alignment E=3.3e-89 PF01081: Aldolase" amino acids 9 to 203 (195 residues), 298.9 bits, see alignment E=7.1e-94

Best Hits

Swiss-Prot: 100% identical to ALKH_DICD3: KHG/KDPG aldolase (eda) from Dickeya dadantii (strain 3937)

KEGG orthology group: K01625, 2-dehydro-3-deoxyphosphogluconate aldolase / 4-hydroxy-2-oxoglutarate aldolase [EC: 4.1.2.14 4.1.3.16] (inferred from 100% identity to dze:Dd1591_2243)

MetaCyc: 100% identical to 2-dehydro-3-deoxy-D-gluconate-6-phosphate aldolase (Dickeya dadantii 3937)
2-dehydro-3-deoxy-phosphogluconate aldolase. [EC: 4.1.2.14, 4.1.2.55]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.14 or 4.1.2.55 or 4.1.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C4L4 at UniProt or InterPro

Protein Sequence (213 amino acids)

>DZA65_RS10585 bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase (Dickeya dianthicola ME23)
MKNWKTSAEQILTAGPVVPVIVINKLEHAVPMAKALVAGGVRVLELTLRTDCAVEAIRLI
AQEVPDAIVGAGTVTNPQQLAEVTAAGAQFAISPGLTEPLLKAATEGTIPLIPGISTVSE
LMLGMDYGLREFKFFPAEANGGVKALQAIAGPFGKIRFCPTGGISLKNYRDYLALKSVLC
VGGSWLVPADALESGDYDRITALAREAVAGATA