Protein Info for DZA65_RS10475 in Dickeya dianthicola ME23

Annotation: tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08003: Methyltransf_9
  • amino acids 7 to 322 (316 residues), 550.2 bits, E=3e-169
• TIGR00452: tRNA (mo5U34)-methyltransferase
  • amino acids 7 to 321 (315 residues), 485.8 bits, E=2.1e-150
• PF13489: Methyltransf_23
  • amino acids 122 to 270 (149 residues), 34 bits, E=5.9e-12
• PF13649: Methyltransf_25
  • amino acids 126 to 205 (80 residues), 28.3 bits, E=5.8e-10
• PF13847: Methyltransf_31
  • amino acids 126 to 229 (104 residues), 28.1 bits, E=4e-10
• PF08241: Methyltransf_11
  • amino acids 127 to 223 (97 residues), 27 bits, E=1.5e-09

Best Hits

Swiss-Prot: 81% identical to CMOB_PECCP: tRNA U34 carboxymethyltransferase (cmoB) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K15257, tRNA (mo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 96% identity to ddd:Dda3937_01610)

MetaCyc: 77% identical to tRNA U34 carboxymethyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-7067

Predicted SEED Role

"tRNA (5-methoxyuridine) 34 synthase"

MetaCyc Pathways

• 5-(methoxycarbonylmethoxy)uridine biosynthesis (3/3 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See A0A385Y0H1 at UniProt or InterPro

Protein Sequence (323 amino acids)

>DZA65_RS10475 tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB (Dickeya dianthicola ME23)
MIDFGNFYQLIAKGPLSHWLNTLPAQISQWQQASLHGEFKHWVNTVEHLPALTPEQLDLT
HGVTAQLNTPLSARQQAGIESLLRNLMPWRKGPFSLYGVDIDTEWRSDWKWDRVLPHISP
LQDRLILDVGCGSGYHLWRMIGAGAHLAVGIDPMQLFLCQFESVRKLLGNDQRAHLLPLG
IEQLPALAAFDTVFSMGVLYHRRSPLDHLWQLKNQLVSGGELVLETLVVEGDEHCVLLPG
ERYSQMRNVYFLPSSAALARWLEKCGFVDIRVVDQCVTTLEEQRRTHWMRTDSLADFLDP
NDRSKTLEGYPAPLRAVLVARKP