Protein Info for DZA65_RS10250 in Dickeya dianthicola ME23

Annotation: multicopper oxidase CueO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 555 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF07732: Cu-oxidase_3" amino acids 55 to 167 (113 residues), 108.6 bits, see alignment E=3.1e-35 PF00394: Cu-oxidase" amino acids 221 to 298 (78 residues), 23.2 bits, see alignment E=1e-08 PF07731: Cu-oxidase_2" amino acids 434 to 554 (121 residues), 83.8 bits, see alignment E=1.5e-27

Best Hits

KEGG orthology group: K14588, blue copper oxidase (inferred from 91% identity to ddd:Dda3937_00009)

Predicted SEED Role

"Blue copper oxidase CueO precursor" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XWW8 at UniProt or InterPro

Protein Sequence (555 amino acids)

>DZA65_RS10250 multicopper oxidase CueO (Dickeya dianthicola ME23)
MRRREFIKLSAMLGVSSLLPWWSRSVWADERPALPIPPLLAPDAGGNIALTLQTGSMRWL
AGQETATWGVNGGFLGPALQLEQGQAVTLNVTNTLPETTTLHWHGLEIPGNADGGPQAEV
APGKTWTAAFRVAQPAATAWFHPHTHGVTGRQVAMGLGGLILIQDAASRALPLPSQWGAD
DIPLLLQDKRLDAKGQIDYQLDVMAAAVGWFGDVMLTNGARYPQHVAPRGWLRLRVLNGC
NARSLTLAASDGRPLYVIGSDGGLLAEPVQVNALNVLMGERFEVLVDARDGKAFDMVTLP
VTQMGMSVPPFDQPLPVLRIQPTLQPGAGRLPETLATLSALPSTAGLKTRQLQLTMDPQL
DMLGMQALMQRYGMQAMAGMNMAGMNMAEHGAMPGMSHGGGTTIPSSAPQQGGMNMNHGA
MAQDGMNHGGMNHPSGPAALDILSGNRINGAAFQMGQPMFDVRRGDVEVWSISGQGDMML
HPFHIHGTRFRILSENGKPPAAHRRGWKDIVHVEGAHSEVLVQFNHPAPKERAFMAHCHL
LEHEDTGMMMSFTVS