Protein Info for DZA65_RS10085 in Dickeya dianthicola ME23

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details PF17203: sCache_3_2" amino acids 36 to 162 (127 residues), 60 bits, see alignment E=4.3e-20 PF02518: HATPase_c" amino acids 421 to 529 (109 residues), 65.8 bits, see alignment E=6.9e-22 PF14501: HATPase_c_5" amino acids 422 to 515 (94 residues), 27.5 bits, see alignment E=3.8e-10

Best Hits

KEGG orthology group: K07700, two-component system, CitB family, cit operon sensor histidine kinase CitA [EC: 2.7.13.3] (inferred from 97% identity to ddd:Dda3937_02968)

Predicted SEED Role

"Sensor kinase CitA, DpiB (EC 2.7.3.-)" in subsystem Orphan regulatory proteins (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XWV4 at UniProt or InterPro

Protein Sequence (531 amino acids)

>DZA65_RS10085 sensor histidine kinase (Dickeya dianthicola ME23)
MTVRLPFHLKLFIYLMIFFSLLLITAGLYYYRAVDQQLYDELGSRAQIQAREIAIIPSLV
DAVKHSDTATIDSLVDQIKARSDASFIVIGDRNATHLYHSEEPSLLGTEMIGGDNKEVLE
GQSTITLRRGAIGISLRSKAPIMEGDRVIGIVSVGYLKKRIDNLTFSKVAHVGLGIIAML
VALFFFSWWFSRNLKKQMFGLEPLEIRLLVRQQKALLESIYEGVIAIDKQRNIAVINHAA
KDLLGLMMPSYQLRGKPIDDVIAPVPFFSNQDIWFHDTHDEICRFNQITVIASRVRIMLE
DELQGWVISFRDKNDLHTLSMQLSQVKRYANSLRILRHEQLNWTATLAGLLHLRRYDEAV
RYIEAQSEGAQVVLDFISSRFCSPALCGLLLGKYASAREKGIELRFDPRCQLNGIPASLS
ETELMSIIGNLIDNAVEATLVSTPAYHPVEVYIHDGEQELVIEVADQGTGIDPAIADRVF
EMGVTSKQEGDHGLGLHLVSSYVSQAQGVIEVSDNSPHGAIFSIFIPKTTL