Protein Info for DZA65_RS10050 in Dickeya dianthicola ME23

Annotation: histidinol-phosphate transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 TIGR01141: histidinol-phosphate transaminase" amino acids 8 to 349 (342 residues), 392.6 bits, see alignment E=7.1e-122 PF00155: Aminotran_1_2" amino acids 30 to 348 (319 residues), 216.7 bits, see alignment E=2.9e-68

Best Hits

Swiss-Prot: 80% identical to HIS8_PECAS: Histidinol-phosphate aminotransferase (hisC) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00817, histidinol-phosphate aminotransferase [EC: 2.6.1.9] (inferred from 95% identity to ddd:Dda3937_02974)

MetaCyc: 73% identical to histidinol-phosphate aminotransferase (Escherichia coli K-12 substr. MG1655)
Histidinol-phosphate transaminase. [EC: 2.6.1.9]

Predicted SEED Role

"Histidinol-phosphate aminotransferase (EC 2.6.1.9)" in subsystem Histidine Biosynthesis (EC 2.6.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CRM3 at UniProt or InterPro

Protein Sequence (356 amino acids)

>DZA65_RS10050 histidinol-phosphate transaminase (Dickeya dianthicola ME23)
MSIDNLARDNVRRLTPYQSARRLGGNGDVWLNANEYPQAPQYQLTLQTLNRYPECQPAQV
IARYAAYAGVAPEQVLVSRGADEGIELLVRAFCEPGKDAILFCPPTYGMYAVSAETFGVE
RRVVPSTADWQLDLAAIEGVLDNVKVIYVCSPNNPTGNRINPEDLRRLLELARGRAIVAI
DEAYIEFCPQATTAGWLAEYPHQVVLRTLSKAFALAGLRCGFTLASAEVIQLLLKVIAPY
PLALPVADIAAQALSETGLAEMRRNVDEVRENRRWLSESLKTLPSVETVYASESNYLLVR
FTDSPTVFKTLWDQGIILRDQNKQPGLAGCLRITIGNRYECERVIGALQALSGKTA