Protein Info for DZA65_RS09970 in Dickeya dianthicola ME23

Annotation: pyruvate formate lyase 1-activating protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 TIGR02493: pyruvate formate-lyase 1-activating enzyme" amino acids 6 to 239 (234 residues), 340.9 bits, see alignment E=3.3e-106 PF13353: Fer4_12" amino acids 16 to 147 (132 residues), 60.6 bits, see alignment E=2.1e-20 PF04055: Radical_SAM" amino acids 24 to 179 (156 residues), 87 bits, see alignment E=1.7e-28

Best Hits

Swiss-Prot: 85% identical to PFLA_ECOL6: Pyruvate formate-lyase 1-activating enzyme (pflA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 97% identity to dze:Dd1591_2346)

Predicted SEED Role

"Pyruvate formate-lyase activating enzyme (EC 1.97.1.4)" in subsystem Fermentations: Mixed acid or Threonine anaerobic catabolism gene cluster (EC 1.97.1.4)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CXN6 at UniProt or InterPro

Protein Sequence (246 amino acids)

>DZA65_RS09970 pyruvate formate lyase 1-activating protein (Dickeya dianthicola ME23)
MSVIGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRDTWDTHGGKEVTVGELMKEV
VTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACHEQGINTCLDTNGFVRRYDPVIDEL
LDVTDLVMLDLKQLNDEVHQNLVGVSNHRTLDFARYLAKRNQRTWIRYVVVPDWSDDDAS
AHQLGAFTKEMHNIEKIELLPYHELGKHKWTAMGEEYKLDGIKPPKADTMDRIKAILASY
GHNVVY