Protein Info for DZA65_RS09960 in Dickeya dianthicola ME23

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 65 (27 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 236 to 254 (19 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details amino acids 326 to 346 (21 residues), see Phobius details amino acids 352 to 370 (19 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 319 (309 residues), 85.3 bits, see alignment E=3.9e-28 PF06779: MFS_4" amino acids 28 to 363 (336 residues), 36.8 bits, see alignment E=3.1e-13

Best Hits

Swiss-Prot: 64% identical to YCAD_SALPC: Uncharacterized MFS-type transporter YcaD (ycaD) from Salmonella paratyphi C (strain RKS4594)

KEGG orthology group: K08219, MFS transporter, UMF2 family, putative MFS family transporter protein (inferred from 97% identity to ddd:Dda3937_03354)

Predicted SEED Role

"Hypothetical MFS-type transporter protein YcaD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D5J3 at UniProt or InterPro

Protein Sequence (382 amino acids)

>DZA65_RS09960 MFS transporter (Dickeya dianthicola ME23)
MSTYTRPVLLLLCGLLLLTVCLAVLNTLVPLWLNDRQLPVWQVGVVGSAYFSGNLLGTLV
AGGLIRIYGFNRSYYLAALMFGLATAALALSPDVGSWILWRFIAGVACALIWVVVESALL
CSGNALNRGQLLAAYMMAYYLGSVVGQLLLGMVPTALFSILPWLVTLALLAVLPLFFARI
PPPQPVTQRVNVWRMLRYRTARLGIQGCVISGIILGSLYGLMPLYLAHQGMSDARVGYWM
ALLISAGIFGQWPVGRMADRYGRLLVLRVLVFAVILGSLAILAPGRYSMAPSLFLLGAAG
FTLYPVAMSWACEKVAPSELVAMNQALLLSYTIGSLCGPSLAAMLMQTYSDQLLFVLIAA
VSLGYLIILLKKADHHPRPLAV