Protein Info for DZA65_RS09845 in Dickeya dianthicola ME23

Annotation: arginine ABC transporter ATP-binding protein ArtP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 PF00005: ABC_tran" amino acids 19 to 170 (152 residues), 135.1 bits, see alignment E=2.6e-43 PF13304: AAA_21" amino acids 141 to 199 (59 residues), 27.1 bits, see alignment E=4.5e-10

Best Hits

Swiss-Prot: 84% identical to ARTP_ECOL6: Arginine transport ATP-binding protein ArtP (artP) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K10000, arginine transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 96% identity to ddc:Dd586_2314)

MetaCyc: 84% identical to L-arginine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-4-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Arginine ABC transporter, ATP-binding protein ArtP" in subsystem Arginine and Ornithine Degradation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y1L0 at UniProt or InterPro

Protein Sequence (242 amino acids)

>DZA65_RS09845 arginine ABC transporter ATP-binding protein ArtP (Dickeya dianthicola ME23)
MSIQLNSINCFYGAHQALFDVTLDCPSGETLVLLGPSGAGKSSLLRVLNLLETPRSGALN
IGGTTFDFNQTPGENAIRELRRNVGMVFQQYNLWPHLTVQQNLVEAPCRVLGLSRQEAQE
RADKLLSRLRLSDFADRYPLHLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQV
VSIIQELSETGITQVIVTHEVDFARKTASRVVYMENGRIVEQGDASHFTQPQTPEFAGYL
SH