Protein Info for DZA65_RS09820 in Dickeya dianthicola ME23

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 35 to 64 (30 residues), see Phobius details amino acids 85 to 109 (25 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 250 to 271 (22 residues), see Phobius details amino acids 283 to 301 (19 residues), see Phobius details amino acids 307 to 330 (24 residues), see Phobius details amino acids 342 to 364 (23 residues), see Phobius details amino acids 370 to 390 (21 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 356 (336 residues), 147.7 bits, see alignment E=6.6e-47 amino acids 242 to 391 (150 residues), 54.8 bits, see alignment E=1.1e-18 PF00083: Sugar_tr" amino acids 47 to 190 (144 residues), 31.1 bits, see alignment E=1.8e-11 amino acids 216 to 358 (143 residues), 38.8 bits, see alignment E=8.2e-14

Best Hits

KEGG orthology group: None (inferred from 98% identity to ddd:Dda3937_03471)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DJA8 at UniProt or InterPro

Protein Sequence (397 amino acids)

>DZA65_RS09820 MFS transporter (Dickeya dianthicola ME23)
MSLDFSTLKRIPKGVWVLGGVSLLMDISSEMIHSLLPLFMTTVLGTSVVVIGLIEGLAEA
TALIVKVFSGALSDYLGKRKGLALLGYGLGAVSKPLFALATSSGLVLGARLLDRVGKGIR
GAPRDALVADVTPPDIRGAAFGLRQSLDTIGAFAGPLLAVVLMLLWQDDFRAIFWVAFIP
GALAIALLFFGLREPEHAGAAKRTNPIRRDNLKRLSTQYWWVVGVGAVFTLARFSEAFLV
LRAQQVEIPVALIPLVMVAMNLVYACSAYPFGKLSDRMDHHSLLKMGLLVLIAADVVLAI
SQHWLGVIIGVALWGVHMGMTQGLLAAMVANTAPADLRGTAYGVFNLISGVALLLASLGA
GILWDVWGAASTFYAGALICLITLAGMALMPRSLSSR