Protein Info for DZA65_RS09815 in Dickeya dianthicola ME23

Annotation: 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 TIGR02085: 23S rRNA (uracil-5-)-methyltransferase RumB" amino acids 2 to 374 (373 residues), 652.3 bits, see alignment E=1.1e-200 PF05958: tRNA_U5-meth_tr" amino acids 208 to 374 (167 residues), 49.5 bits, see alignment E=5.1e-17 PF05175: MTS" amino acids 230 to 311 (82 residues), 24.5 bits, see alignment E=2.7e-09 PF13847: Methyltransf_31" amino acids 239 to 294 (56 residues), 30.2 bits, see alignment 5.6e-11

Best Hits

Swiss-Prot: 78% identical to RLMC_PECCP: 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC (rlmC) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03212, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 95% identity to ddd:Dda3937_03472)

MetaCyc: 68% identical to 23S rRNA m5U747 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11600 [EC: 2.1.1.189]

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase rumB (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.189

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XXK7 at UniProt or InterPro

Protein Sequence (376 amino acids)

>DZA65_RS09815 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC (Dickeya dianthicola ME23)
MQCARYNDGSCRSCQWLETAYPQQVADKQQHLLGLLAAHPVQCWLTPVASAEVAFRNKAK
MVVSGSVERPLLGMLHRDGSAVDLCDCPLYPDSVAPVFSVLKTFIARAGLTPYNVARRRG
ELKYLLLTQSTLSGRFMLRFVLRSEAKLAQLRAALPWLQQQLPQLAVISANIQPVHQAIL
EGEQEIPLTQAQALEERFNQVPLYIRPQSFFQTNPQVAAALYDAARQWVSALPVRSLWDL
FCGVGGFGLHCASPETPLTGIEISPEAIDCARRSAVQLGLTNVSFAALDSTRFAVGEART
PDLVIVNPPRRGIGAELCDYLSRMAPPYLLYSSCNAESMAKDIARLPAYQIQQAQLFDMF
PHTAHYEVLTLLQRRV