Protein Info for DZA65_RS09795 in Dickeya dianthicola ME23

Annotation: putrescine ABC transporter ATP-binding subunit PotG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 PF00005: ABC_tran" amino acids 34 to 175 (142 residues), 140.5 bits, see alignment E=5.7e-45 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 48 to 373 (326 residues), 485 bits, see alignment E=5e-150 PF08402: TOBE_2" amino acids 293 to 373 (81 residues), 76.1 bits, see alignment E=2e-25

Best Hits

Swiss-Prot: 85% identical to POTG_ECOLI: Putrescine transport ATP-binding protein PotG (potG) from Escherichia coli (strain K12)

KEGG orthology group: K11076, putrescine transport system ATP-binding protein (inferred from 98% identity to ddd:Dda3937_03476)

MetaCyc: 85% identical to putrescine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Putrescine transport ATP-binding protein PotG (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y1J6 at UniProt or InterPro

Protein Sequence (375 amino acids)

>DZA65_RS09795 putrescine ABC transporter ATP-binding subunit PotG (Dickeya dianthicola ME23)
MNEAIPRPKPQKAATPLLEVRNLTKSYDDQFAVDDVSLTIYKGEIFALLGASGCGKSTLL
RMLAGFEQPTQGHIVLDGQDLSLVPPYQRPINMMFQSYALFPHMTVEKNIAFGLKQDKLS
RGEINDRVEEMLTLVHMQEFARRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDK
KLRDRMQLEVVDILERVGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYENPN
SRFSAEFIGSVNMFDGLLKERQDDALIVQSPGLVHPLKVNSDVSVVDGVPVYIALRPEKI
MLCDEVPADGCNFAVGEVVHIAYLGDLSIYHVRLNSGQTISAQLQNADRFRKGSPTWGDE
VRLCWDADSCVVLTV