Protein Info for DZA65_RS09775 in Dickeya dianthicola ME23

Annotation: oxygen-insensitive NADPH nitroreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF00881: Nitroreductase" amino acids 8 to 159 (152 residues), 59.7 bits, see alignment E=4.4e-20 PF28600: Nitroreductase_C" amino acids 167 to 239 (73 residues), 83.3 bits, see alignment E=1.7e-27

Best Hits

Swiss-Prot: 72% identical to NFSA_SALTY: Oxygen-insensitive NADPH nitroreductase (nfsA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10678, nitroreductase [EC: 1.-.-.-] (inferred from 95% identity to ddd:Dda3937_03480)

MetaCyc: 69% identical to NADPH-dependent nitro/quinone reductase NfsA (Escherichia coli K-12 substr. MG1655)
R303-RXN [EC: 1.7.1.16]; RXN0-7385 [EC: 1.7.1.16, 1.6.5.10]

Predicted SEED Role

"Oxygen-insensitive NADPH nitroreductase (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.6.5.10 or 1.7.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D476 at UniProt or InterPro

Protein Sequence (240 amino acids)

>DZA65_RS09775 oxygen-insensitive NADPH nitroreductase (Dickeya dianthicola ME23)
MTPTIALLRQHRSIRSFTDQLLSDEQRNAIIAAAQSASTSSFLQCSSIIRITEPALRSQL
VQLTGEQPWVGQAAEFWVFCADFHRHQQIYPQAELGLAEQLLLGCVDTALMGQNALVAAE
SIGLGGVFIGGVRNQIAEVTRLLALPQQVLPLFGLCLGYPAAQPALKPRLPAALVVHENR
YQPLDSALLAEYDQHIVEYYRHRDSNQRMESWSDQIRRTLSKERRPFMLDYLRQQGWATR