Protein Info for DZA65_RS09705 in Dickeya dianthicola ME23

Annotation: outer membrane permeability protein SanA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF02698: DUF218" amino acids 47 to 170 (124 residues), 65.1 bits, see alignment E=3.3e-22

Best Hits

Swiss-Prot: 74% identical to SANA_ECOLI: Protein SanA (sanA) from Escherichia coli (strain K12)

KEGG orthology group: K03748, SanA protein (inferred from 97% identity to ddd:Dda3937_03495)

Predicted SEED Role

"SanA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CX16 at UniProt or InterPro

Protein Sequence (250 amino acids)

>DZA65_RS09705 outer membrane permeability protein SanA (Dickeya dianthicola ME23)
MWKRLIFGLFTAILVMAGGAFLLDRCISWRTAPYIYEDVQDLPPRQVGVVLGTAKYYRAG
VINQYYLFRIQGALNAYNSGKVSYLLLSGDNAQQSYNEPMTMRRDLIAAGVPPTNIVLDY
AGFRTLDSIVRTRKVFDTNDFTIITQRFHCERALFIALHKGIQAQCFAVPSPKDIWQVRL
REFGARLGTLFDLYILKREPRFLGPQVPIPSEYKISDDEPSYPAVPPEFMNEPDSRVEPQ
LRQKPPPTSR