Protein Info for DZA65_RS09600 in Dickeya dianthicola ME23

Annotation: sugar transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details amino acids 299 to 321 (23 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 349 (332 residues), 129.6 bits, see alignment E=6.7e-42

Best Hits

Swiss-Prot: 97% identical to SOTB_DICCH: Sugar efflux transporter B (sotB) from Dickeya chrysanthemi

KEGG orthology group: K08159, MFS transporter, DHA1 family, L-arabinose/isopropyl-beta-D-thiogalactopyranoside export protein (inferred from 97% identity to ddd:Dda3937_03617)

MetaCyc: 65% identical to L-arabinose exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-40

Predicted SEED Role

"Sugar efflux transporter SotB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C2B6 at UniProt or InterPro

Protein Sequence (395 amino acids)

>DZA65_RS09600 sugar transporter (Dickeya dianthicola ME23)
MTSASSSRSAAWLRVVTLAVAAFIFNTTEFIPVGLLSDIANSFAMKTEDVGLMITIYAWI
VAVASLICMLLTSGIERRKLLIGLFGLFILSHLLSAVAWNFTVLVISRAGVALTHSVFWS
ITASLAIRMAPPGKRAQALGLIATGSSLAMVLGLPLGRVIGQYLGWRATFLTIAAGATVA
MILLARLLPLLPSEHSGSLSSVPKLFRRPALVGIYLLTVVVVTAHFTAYSYIEPFIQTVA
GLPENFTTLILLLFGCAGIVGSMIYSRYSERFPIGFLVTAMLLLLACLTLLMPLSGYPFG
LTLLCLVWGLAMMSIGLAMQAKVLSLAPDASDVAMSIFSGLFNLGIGGGALLGSQVSLHL
GMDKIGYVGAPLVLLALFATLLSVYRSVRLVHSRI