Protein Info for DZA65_RS09595 in Dickeya dianthicola ME23

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 56 to 79 (24 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 351 to 368 (18 residues), see Phobius details amino acids 374 to 397 (24 residues), see Phobius details amino acids 418 to 438 (21 residues), see Phobius details amino acids 450 to 470 (21 residues), see Phobius details PF00324: AA_permease" amino acids 24 to 474 (451 residues), 495.7 bits, see alignment E=1.3e-152 PF13520: AA_permease_2" amino acids 25 to 445 (421 residues), 127.8 bits, see alignment E=5.6e-41

Best Hits

Swiss-Prot: 83% identical to LYSP_ECOLI: Lysine-specific permease (lysP) from Escherichia coli (strain K12)

KEGG orthology group: K11733, lysine-specific permease (inferred from 98% identity to ddd:Dda3937_03618)

MetaCyc: 83% identical to lysine:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-58

Predicted SEED Role

"Lysine-specific permease" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D169 at UniProt or InterPro

Protein Sequence (490 amino acids)

>DZA65_RS09595 amino acid permease (Dickeya dianthicola ME23)
MAQHETHSAEQRGTTLRRELKARHLTMIAIGGSIGTGLFVASGATVSQAGPGGAMLSYAL
IGLMVYFLMTSLGELAAFMPVSGSFSTYGARYVEEGFGFALGWNYWYNWAVTIAVDLVAA
QLVMGYWFPSAPGWVWSALFLSLMFLLNYISVKGFGEAEYWFSLIKVTTVILFIAIGLLM
MFGILRGGEHAGWHNWQIGDAPFAGGFSAMIGVAMIVGFSFQGTELIGVAAGESKDPQTT
IPRAVRQVFWRILLFYIFAILIISLLVPYTDPNLLRNDVKDISVSPFTLVFENAGLLSAA
AVMNAVILTAVLSAGNSGMYASTRMLFTLAQEGKAPACFGKLSKGGVPRNALYVTTVVAG
LCFLSSMFGNQTVYLWLLNTSGMTGFIAWLGIAISHYRFRRGYVMQGRDLSSLPYRSGFF
PLGPIFAFVLCLVITLGQNYQAFLADKIDWYAVTATYIGIPLFLAIWLGFRLVKGSRVVK
YSEMTFPEHK