Protein Info for DZA65_RS09580 in Dickeya dianthicola ME23

Annotation: deoxyribonuclease IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 TIGR00587: apurinic endonuclease (APN1)" amino acids 3 to 276 (274 residues), 349.4 bits, see alignment E=6.6e-109 PF01261: AP_endonuc_2" amino acids 18 to 277 (260 residues), 213.2 bits, see alignment E=2.5e-67

Best Hits

Swiss-Prot: 83% identical to END4_PECCP: Probable endonuclease 4 (nfo) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K01151, deoxyribonuclease IV [EC: 3.1.21.2] (inferred from 98% identity to ddd:Dda3937_03621)

MetaCyc: 75% identical to endonuclease IV (Escherichia coli K-12 substr. MG1655)
3.1.4.-; 3.1.4.-; 3.1.3.-; Deoxyribonuclease IV (phage-T(4)-induced). [EC: 3.1.21.2]; 3.1.21.- [EC: 3.1.21.2]

Predicted SEED Role

"Endonuclease IV (EC 3.1.21.2)" in subsystem DNA repair, bacterial (EC 3.1.21.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CTZ9 at UniProt or InterPro

Protein Sequence (291 amino acids)

>DZA65_RS09580 deoxyribonuclease IV (Dickeya dianthicola ME23)
MKYVGAHVSASGGVDQAVARAHDIGATAFALFTKNQRQWQAPPLAADVIDRFRAACAQYQ
FTPAQILPHDSYLINLGHPDDDALQKSQAAFIDEMSRCQQLGLTLLNFHPGSHLRQIDES
ACLSRIAQSINLALDATAGVTAVIENTAGQGSNLGFRFEHLAEIISQVEDKSRVGVCIDT
CHAFAGGYDLRAEADCEHTFAELERVVGFRYLRGMHLNDAKSEFNSRVDRHHSLGEGNIG
KTVFSYIMRDPRFDDIPLILETINPDIWAQEIAWLKSQQSPNASSKHRRLQ