Protein Info for DZA65_RS09575 in Dickeya dianthicola ME23

Annotation: PTS fructose transporter subunit IIBC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 transmembrane" amino acids 236 to 258 (23 residues), see Phobius details amino acids 268 to 291 (24 residues), see Phobius details amino acids 303 to 329 (27 residues), see Phobius details amino acids 349 to 369 (21 residues), see Phobius details amino acids 381 to 403 (23 residues), see Phobius details amino acids 415 to 451 (37 residues), see Phobius details amino acids 463 to 483 (21 residues), see Phobius details amino acids 489 to 512 (24 residues), see Phobius details amino acids 519 to 551 (33 residues), see Phobius details PF25554: PTS_EIIB_BC_N" amino acids 1 to 88 (88 residues), 110.7 bits, see alignment E=4.7e-36 amino acids 103 to 204 (102 residues), 42.1 bits, see alignment E=1.2e-14 TIGR00829: PTS system, Fru family, IIB component" amino acids 105 to 188 (84 residues), 129.3 bits, see alignment E=5.2e-42 PF02302: PTS_IIB" amino acids 105 to 189 (85 residues), 71 bits, see alignment E=1.6e-23 TIGR01427: PTS system, Fru family, IIC component" amino acids 220 to 552 (333 residues), 468.2 bits, see alignment E=1.9e-144 PF02378: PTS_EIIC" amino acids 233 to 496 (264 residues), 70.5 bits, see alignment E=2.1e-23

Best Hits

Swiss-Prot: 74% identical to PTFBC_ECOLI: PTS system fructose-specific EIIB'BC component (fruA) from Escherichia coli (strain K12)

KEGG orthology group: K02769, PTS system, fructose-specific IIB component [EC: 2.7.1.69] K02770, PTS system, fructose-specific IIC component (inferred from 96% identity to ddd:Dda3937_03623)

MetaCyc: 74% identical to fructose-specific PTS multiphosphoryl transfer protein FruA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"PTS system, fructose-specific IIB component (EC 2.7.1.69) / PTS system, fructose-specific IIC component (EC 2.7.1.69)" in subsystem Fructose utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C389 at UniProt or InterPro

Protein Sequence (561 amino acids)

>DZA65_RS09575 PTS fructose transporter subunit IIBC (Dickeya dianthicola ME23)
MKTLLILDKSLGLAKSRLVKNLLGAAAANAGLTLTEQFADAELAIVLGAPVQADSGLNGK
KVFAGDIELALSQPVAFLEKAKAQALPYQAPAAAAAAPAAAKRIVAVTACPTGVAHTFMA
AEAIESEAKKRGWWVKVETRGSVGAGNPISPEEVEQADLVIVAADIEVDLSKFAGKKMYR
TSTGLALKKTAQEFDKALSEAAVFQPSAQNGVAAGGESAKKGGVGPYRHLLTGVSYMLPM
VVAGGLCIALSFVFGITAFKEEGTLAAALMKIGGGSAFALMVPILAGYIAFSIADRPGLT
PGLVGGMLAVSTGAGFLGGIIAGFLAGYLARAISNHVKLPQSMSALKPILIIPLFATLIT
GLIMIYVVGTPVAKILTGLTSWLQSMGTANAVILGAVLGGMMCTDMGGPVNKVAYVFGTT
LLSSQVYAPMAAVMAAGMVPPLAMGLATFIAGKKFTDSEREGGKAAVVLGLCFISEGAIP
YAARDPMRVLPSCILGGALTGALSMAVGAKLMAPHGGLFVLLIPGAITPVLGYLFSIVAG
TVVAGVLYAVLKRPEEQLVKA