Protein Info for DZA65_RS09550 in Dickeya dianthicola ME23

Annotation: elongation factor P-like protein YeiP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 TIGR02178: elongation factor P-like protein YeiP" amino acids 3 to 189 (187 residues), 327.3 bits, see alignment E=1.8e-102 PF08207: EFP_N" amino acids 4 to 60 (57 residues), 51.6 bits, see alignment E=1.1e-17 PF01132: EFP" amino acids 68 to 126 (59 residues), 55.6 bits, see alignment E=5.8e-19 PF09285: Elong-fact-P_C" amino acids 133 to 188 (56 residues), 72.8 bits, see alignment E=2.3e-24

Best Hits

Swiss-Prot: 90% identical to EFPL_PECAS: Elongation factor P-like protein (ECA2732) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02356, elongation factor P (inferred from 98% identity to dze:Dd1591_2429)

Predicted SEED Role

"Translation elongation factor P-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CX09 at UniProt or InterPro

Protein Sequence (190 amino acids)

>DZA65_RS09550 elongation factor P-like protein YeiP (Dickeya dianthicola ME23)
MARANEIKRGMAVNYNGKLLLVKDIDIQSPSARGASTLYKMRFSDVRTGLKVEERFKGDD
ILDTITLTRRSVTFSYIDGDEYIFMDEEDYTPYTFKKEQIEDELLFIPEGGMPGIQVLTM
DGQLLALELPQTVDLEIVETAPGIKGASASSRNKPATLTTGLVIQVPEYLSAGEKIRIHI
AERRYMGRAD