Protein Info for DZA65_RS09540 in Dickeya dianthicola ME23

Annotation: bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00877: NLPC_P60
  • amino acids 79 to 183 (105 residues), 117.3 bits, E=1.4e-38

Best Hits

Swiss-Prot: 68% identical to MEPS_ECOLI: Murein DD-endopeptidase MepS/Murein LD-carboxypeptidase (mepS) from Escherichia coli (strain K12)

KEGG orthology group: K13694, lipoprotein Spr (inferred from 98% identity to ddd:Dda3937_03829)

MetaCyc: 68% identical to peptidoglycan endopeptidase/peptidoglycan L,D-carboxypeptidase (Escherichia coli K-12 substr. MG1655)
Muramoyltetrapeptide carboxypeptidase. [EC: 3.4.17.13]; 3.4.-.- [EC: 3.4.17.13]; 3.4.-.- [EC: 3.4.17.13]

Predicted SEED Role

"Lipoprotein spr precursor"

MetaCyc Pathways

• peptidoglycan recycling I (13/14 steps found)
• muropeptide degradation (3/4 steps found)
• peptidoglycan recycling II (6/10 steps found)
• peptidoglycan maturation (meso-diaminopimelate containing) (4/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.17.13

Sequence Analysis Tools

See A0A385XWS7 at UniProt or InterPro

Protein Sequence (191 amino acids)

>DZA65_RS09540 bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase (Dickeya dianthicola ME23)
MVKSQPTLRYIWRVLPAVAVAVMLSACTSNTASVNNQTDRRVVNGGDPSLQASQDEFEAM
VRNVEVKSKLLEQYANWKGVRYRLGGDSRKGIDCSGFVQRTFREQFGMDLPRSSYEQQDI
GVQIQRNKLRPGDLVVFHAGSTGRHMGIYIGNQQFVHASTSIGVTISSMDDNYWKPRYRE
ARRVLKQDSHS