Protein Info for DZA65_RS09505 in Dickeya dianthicola ME23

Annotation: Bcr/CflA family multidrug efflux MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 9 to 31 (23 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 135 to 160 (26 residues), see Phobius details amino acids 166 to 185 (20 residues), see Phobius details amino acids 216 to 239 (24 residues), see Phobius details amino acids 251 to 268 (18 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details amino acids 306 to 332 (27 residues), see Phobius details amino acids 344 to 363 (20 residues), see Phobius details amino acids 369 to 390 (22 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 8 to 382 (375 residues), 442.4 bits, see alignment E=9.4e-137 PF07690: MFS_1" amino acids 16 to 358 (343 residues), 175 bits, see alignment E=2.1e-55 PF00083: Sugar_tr" amino acids 46 to 188 (143 residues), 45.6 bits, see alignment E=4.9e-16

Best Hits

Swiss-Prot: 66% identical to BCR_ECOLI: Bicyclomycin resistance protein (bcr) from Escherichia coli (strain K12)

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 97% identity to ddd:Dda3937_03823)

MetaCyc: 66% identical to multidrug efflux pump Bcr (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-340; TRANS-RXN-44

Predicted SEED Role

"MFS family multidrug transport protein, bicyclomycin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C6J4 at UniProt or InterPro

Protein Sequence (393 amino acids)

>DZA65_RS09505 Bcr/CflA family multidrug efflux MFS transporter (Dickeya dianthicola ME23)
MQPPSSSRVGLIFILGLISMLMPIAIDMYLPALPVIAKEFSVDPSRVQMTLSSYVLGFAI
GQIFYGPMSDSIGRKPVILGGVLIFTLAAAACALSQTVDQLIHMRFLHGLSAASASVVIN
ALMRDMFSKDEFSRMMSFVILVMTVAPLLAPIIGGALLFWLSWHAIFWTIAAASLVATVL
VWLFVRETLPVERRQRFHLRTTLGNFFQLVRHRRVFSYMFASGLSFSGMFAFLSAGPFVY
IDLNGVSPQHFGYYFALNIVFLFLMTLLNSRIVARMGAMFMFRLGLIIQFVMGIWLVVVS
SFHLGFIPLVVGVAVFVGCVATVASNAMAVILDDFPHMAGTASSLAGTMRFGLGSLMGSL
LSLTTFQSVWPMVGAMAFCSAGAFGLFLYASRR