Protein Info for DZA65_RS09490 in Dickeya dianthicola ME23

Annotation: DEAD/DEAH box helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 601 PF04851: ResIII" amino acids 3 to 155 (153 residues), 101.9 bits, see alignment E=7.3e-33 PF00270: DEAD" amino acids 6 to 153 (148 residues), 53.1 bits, see alignment E=6.6e-18 PF00271: Helicase_C" amino acids 264 to 358 (95 residues), 52.3 bits, see alignment E=1.3e-17

Best Hits

KEGG orthology group: None (inferred from 95% identity to ddd:Dda3937_04324)

Predicted SEED Role

"ATP-dependent RNA helicase YejH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XZX6 at UniProt or InterPro

Protein Sequence (601 amino acids)

>DZA65_RS09490 DEAD/DEAH box helicase (Dickeya dianthicola ME23)
MSFTLRPYQQEAVDATLAYFRQHTAPAVIVLPTGAGKSLVIAELARLARGRVLVLAHVRE
LVEQNHAKYCALGLQADIFAAGLNQHDSEGKVVFGSVQSVARHPDKFDDAFSLLIVDECH
RISDDENSQYQQIIQQAQQANPQLRLLGLTATPYRLGRGWIYQYHYHGMIRGDDGCLFRD
CIYELPLRYMIRHGFLVPPERLDMPVVQYDFSQLAARSDGLFNNGLFNNGLFNNGRFSDV
ELNRELKRQQRVTPHIVRQITEYAANRRGVMIFAATVEHAREVAGLLPASEAALISGETP
APQRDALIAAFKQQQLRYLVNVSVLTTGFDAPHVDVIAILRPTESVSLYQQIIGRGLRLF
PGKSDCLILDYAGNPFDLYTPEVGHSKPHSDSQPVQVFCPQCGFANLFWGKCTDDGSVIE
HYGRRCQGWQADEQGRRQQCDYRFRFKSCPHCGAENDIAARRCQSCEAVLVDPDDMLKAA
LKLKDALVLRCSGMNLQHGADAKGEWLRITYYDEDGADVSERFRLHTAAQRSAFTHVFLR
AHQRAPGVPFQWQRADDVVAQQALLRAPDFVVARLQGKFWQVREKIFDYQGRYRRAHELR
G