Protein Info for DZA65_RS09485 in Dickeya dianthicola ME23

Annotation: 50S ribosomal protein L25

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 95 PF01386: Ribosomal_L25p" amino acids 4 to 92 (89 residues), 80.5 bits, see alignment E=4.8e-27

Best Hits

Swiss-Prot: 74% identical to RL25_SERP5: 50S ribosomal protein L25 (rplY) from Serratia proteamaculans (strain 568)

KEGG orthology group: K02897, large subunit ribosomal protein L25 (inferred from 92% identity to dze:Dd1591_2441)

MetaCyc: 68% identical to 50S ribosomal subunit protein L25 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L25p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CDA9 at UniProt or InterPro

Protein Sequence (95 amino acids)

>DZA65_RS09485 50S ribosomal protein L25 (Dickeya dianthicola ME23)
MITINAEVRKEQGKGASRRLRITGKFPAIVYGGSEAPVSIELDHDIIKNLEDRNSEALFG
EIALVVDGKETKVKIQAVQRHPFKPKLTHIDFVRI